Location: United States
Member Since: Aug. 21, 2010

Sign in to subscribe to email alerts for Abundant Truth Publishing

Abundant Truth Publishing

Publisher info

Abundant Truth Publishing is the publishing ministry and extension of Abundant Truth International Ministries. Abundant Truth Publishing offers resources designed to strengthen Christians for victorious living and prepare them to stand in defense of the faith.

Abundant Truth Publishing offers a variety of books and teaching resources for the Christian community. Whether for apologetics, seminars, workshops, bible studies, or personal enrichment, Abundant Truth Publishing can provide the necessary materials.

Where to find Abundant Truth Publishing online

Website: http://abundantpublishing.net
Twitter: @abundantpubs
Facebook: Facebook profile
Blog: https://abundantpublishing.blogspot.com

Where to buy in print

http://amazon.com/author/roderickevans

Publisher of

Sort by:
Authors
Newest
Bestsellers
Highest Rated
Apostolic Authority Deluxe Edition (2 Books in 1): The Apostle Question & The Apostolic Paradigm Shift by
Series: Abundant Truth Deluxe Editions, Book 1. Price: $17.95 USD. Words: 30,400. Language: English. Published: August 19, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Ministry / General
Two powerful books concerning apostolic ministry in one edition! From the library of Abundant Truth Publishing: The Apostle Question & The Apostolic Paradigm Shift.
The God of Another Chance: Overcoming Your Failures, Possessing Your Divine Destiny by
Series: Restoration and Recovery Series. Price: $6.95 USD. Words: 8,400. Language: English. Published: August 18, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
In this book, we will examine the failures and ultimate successes of biblical characters.
Christian Discipleship 101: Lessons for Spiritual Growth and Maturity in the Christian Life by
Series: Kingdom Study Series. Price: $6.95 USD. Words: 7,760. Language: English. Published: August 12, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / Spiritual Growth, Nonfiction » Religion & Spirituality » Christian Ministry / Discipleship
In this study, we will examine three parables: the parables of the hidden treasure, the pearl of great price, and the unmerciful servant. As we learn from these parables, we will stay on the path to true discipleship.
The Successful Christian 101: Twelve Lessons for Mastering the Art of Christian Life and Service by
Series: Kingdom Study Series. Price: $10.95 USD. Words: 18,320. Language: English. Published: August 7, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / Spiritual Growth
In the pages of this study, we will discuss twelve areas that are important to successful Christian living. In mastering these areas, the Christian is able to live in the abundant life.
Apostolic and Prophetic Foundations 101: Foundational Studies for the Apostolic and Prophetic Ministries by
Series: Abundant Truth Ministry Study Series. Price: $9.95 USD. Words: 25,420. Language: English. Published: August 5, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Church / Leadership
The focus of this teaching and study material is to bring clarity and understanding to the apostolic and prophetic offices.
The Prophetic Mantle: The Gift of Prophecy and Prophetic Operations in the Church Today by
Series: Ministerial Endowments Series. Price: $9.95 USD. Words: 15,220. Language: American English. Published: August 4, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Theology / Pneumatology, Nonfiction » Religion & Spirituality » Christian Life / Inspirational
The focus of this book is to bring clarity to the gift of prophecy, prophetic operations, and to the pitfalls associated with prophetic ministry.
Magnify the Lord: Understanding the Dynamics of Worship and Praise by
Series: Mikhtam Music Worship Series, Book 2. Price: $5.95 USD. Words: 4,060. Language: English. Published: December 10, 2013 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In this book, we will discuss the three important dimensions of worship. Through the examination of biblical and religious terminology, a proper understanding of the exhortation, “Magnify the Lord” is established.
Psalms, Hymns, and Spiritual Songs: Understanding the Call to Worship by
Series: Mikhtam Music Worship Series, Book 1. Price: $9.95 USD. Words: 10,190. Language: English. Published: December 10, 2013 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In this book, we will discuss the various dimensions of worship. Through the examination of biblical and religious terminology, a proper understanding of the believer’s Call to Worship is established.
Keys to Pastoral Ministry and Recovery: Help for Wounded Healers by
Series: Kingdom Keys Series. Price: $3.95 USD. Words: 2,380. Language: English. Published: October 19, 2013 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Ministry / General
In this issue, we will discuss the need for ministry among pastors and leaders. We want to briefly examine the influences surrounding this problem in leadership.
The Teaching Ministry: Exploring the Teaching Office and Gift by
Series: Kingdom Stewards Series. Price: $6.95 USD. Words: 4,390. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Ministry / General
The focus of this book is to bring clarity and understanding to the teaching office and the teaching anointing.
The Pastoral Ministry: Exploring the Pastoral Office and Gift by
Series: Kingdom Stewards Series. Price: $6.95 USD. Words: 4,600. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Ministry / General
The focus of this book is to bring clarity and understanding to the pastoral office and the pastoral anointing.
The Lazarus Effect: Experiencing a Personal Resurrection by
Series: Restoration and Recovery Series. Price: $5.95 USD. Words: 6,070. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
In this book, learn how you can experience a Lazarus Effect in your personal life.
Keys to Patience: Understanding the Patience Factor in the Christian Life by
Series: Kingdom Keys Series. Price: $2.99 USD. Words: 1,700. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
In this publication, we will discuss "the patience factor." We will discover truths about patience and its importance in the Christian life.
Keys to Understanding the Process: Understanding God's Preparation by
Series: Kingdom Keys Series. Price: $5.95 USD. Words: 5,090. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
Learn how to recognize and submit to God's preparation in your life for Christian life and service.
The Doctrine of Sanctification: Understanding Sanctification and Holiness in the Christian Life by
Series: Kingdom Discipleship Series. Price: $4.95 USD. Words: 2,770. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
In this issue, we will discuss the doctrine of sanctification and its place in the Christian s life. In addition, we will explore the conditional and positional aspects of sanctification and its relationship to holiness.
Walk in the Spirit: Biblical Studies in Christian Conduct by
Series: Kingdom Citizens Series. Price: $5.95 USD. Words: 3,160. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
God has a standard of living that we, as believers, must live by. However, we must remember that our good works and acts must be a product of Christ’s character being formed in us. This is done as the Christian endeavors live a Spirit-filled life. In this publication, we will examine the proper approach to walking in the Spirit and having conduct reflective of a vibrant faith in Christ.
The Chastening of the Lord: Biblical Studies in God's Discipline by
Series: Kingdom Citizens Series. Price: $5.95 USD. Words: 2,810. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
In this publication, we will look closely at the place of God’s discipline in the Christian Life.
Let This Mind Be In You: Biblical Studies in Christian Character by
Series: Kingdom Citizens Series. Price: $5.95 USD. Words: 3,720. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
In this publication, we will discuss Kingdom Character. We will examine the appropriate character of the Christian.
No Man Knows the Hour: Biblical Studies in the Coming Kingdom by
Series: Kingdom Citizens Series. Price: $5.95 USD. Words: 3,450. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
In this publication, we will discuss the coming Kingdom of heaven.
Conformed to His Image: Biblical Studies in Predestination by
Series: Kingdom Citizens Series. Price: $5.95 USD. Words: 2,300. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / General
In this publication, we will discuss the predestination of God. When we speak of predestination in this publication, we are referring to what God has intended or purposed for your life.
Enoch, the Righteous: A Brief Expository of the Man Who Pleased God by
Series: Kingdom Characters Series. Price: $4.95 USD. Words: 2,920. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Biblical Studies / Bible Study Guides
In this publication, we will explore the life of Enoch. Through his example, we will learn how to please the Lord in our walk with him.
Manasseh, the Repentant: A Brief Expository of the Forgetful King by
Series: Kingdom Characters Series. Price: $5.95 USD. Words: 4,980. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Theology / General
In this publication, we will explore the life of Manasseh, the son of Hezekiah. It is our hope that this story will challenge believers to forsake anything that displeases the Lord.
Motives in Ministry: Defining the Proper Motives for Ministry and Service by
Series: Abundant Truth Leadership Series. Price: $6.95 USD. Words: 5,500. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Ministry / General
In this brief study, we will examine the proper motives for Christian ministry and service; and also motives to avoid.
Study to Show Yourself Approved: Exploring Christian Concepts for Victorious Living by
Series: Abundant Truth International's Inspirational Series. Price: $6.95 USD. Words: 7,720. Language: English. Published: October 17, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / Inspirational
In this book, we have compiled select teachings and exhortations to help the Christian become the proverbial master of his domain.
The Walk of Faith: Exploring Christian Precepts for Victorious Living by
Series: Abundant Truth International's Inspirational Series. Price: $6.95 USD. Words: 7,910. Language: English. Published: October 17, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Life / Inspirational
In this book, we have compiled select teachings and exhortations to transform the Christian's walk with Christ.
The Heavens Declare: A Poetical Anthology Extolling Christ's Faithfulness by
Series: Poetry Anthology Series. Price: $4.95 USD. Words: 1,930. Language: English. Published: June 2, 2012 by Abundant Truth Publishing. Categories: Poetry » American poetry » African American, Fiction » Anthologies » Poetry - single author
The poems in this mini anthology demonstrate, reflect, and express Christ’s greatness and faithfulness.
I'm Just Sayin': A Poetry Anthology for Life Moments by
Series: Poetry Anthology Series. Price: $6.95 USD. Words: 2,490. Language: English. Published: June 2, 2012 by Abundant Truth Publishing. Categories: Poetry » American poetry » African American, Fiction » Anthologies » Poetry - single author
The poems presented in this anthology express feelings and thoughts accompanying these life moments.
Sanctuary for the Soul: A Poetical Anthology for Life's Journey by
Series: Poetry Anthology Series. Price: $4.95 USD. Words: 2,080. Language: English. Published: June 2, 2012 by Abundant Truth Publishing. Categories: Poetry » American poetry » African American, Fiction » Anthologies » Poetry - single author
The poems in this anthology are crafted to encourage those of the Christian faith.
Troubled on Every Side: How God Uses People and Problems to Prepare Us for Ministry and Service by
Series: Abundant Truth Leadership Series. Price: $4.95 USD. Words: 4,010. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Ministry / General
In the pages of this book, we will discuss how God uses problematic people and situations to prepare us before and during ministry for effective service.
The Prophetic Ministry: Exploring the Prophetic Office and Gift by
Series: Kingdom Stewards Series. Price: $6.95 USD. Words: 8,180. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Ministry / General
This publication presents a solid introduction to the prophetic ministry. It will bring clarity and understanding to the prophetic office, the prophetic anointing, and the gift of prophecy.
The Apostolic Ministry: Exploring the Apostolic Office and Gift by
Series: Kingdom Stewards Series. Price: $6.95 USD. Words: 7,390. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christian Ministry / General
This publication presents a solid introduction to the apostolic ministry. It will bring clarity and understanding to the apostolic office, the apostolic anointing, and apostleship.
The Mystery of Sonship: Exploring the Relationship Between Salvation, Servanthood, and Sonship by
Series: Kingdom Mystery Series. Price: $6.95 USD. Words: 6,010. Language: English. Published: April 16, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Biblical Studies / Paul’s Letters
In this book, we will explore the mystery of sonship. Our salvation does not only entitle us to right-standing with God, but also relationship.
The Epistle of Titus: The Evans Practical Bible Commentary by
Series: Abundant Truth International's Bible Reference Series. Price: $7.95 USD. Words: 5,300. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Biblical Commentary / New Testament
In this commentary, we will examine one of the pastoral letters of Paul. In his epistle to Titus, the Christian learns of the controversies and challenges facing the early church. The Christian is reminded to be demonstrators of the gospel message in private and public affairs. In doing so, the gospel of Christ is adorned.
The Epistle of Philemon: The Evans Practical Bible Commentary by
Series: Abundant Truth International's Bible Reference Series. Price: $6.95 USD. Words: 4,100. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Biblical Commentary / New Testament
In this commentary, learn valuable lessons for the Christian faith. Paul's epistle to Philemon reminds Christians of the respect that should be present in the Church.
The Epistle of Jude: The Evans Practical Bible Commentary by
Series: Abundant Truth International's Bible Reference Series. Price: $7.95 USD. Words: 5,700. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Biblical Commentary / New Testament
In this commentary, discover practical truths for the Christian life. Jude wrote to warn the believers against false brethren and to challenge them to contend for the faith of Jesus Christ.
Leviticus 1 (The Burnt Offering): The Evans Practical Bible Commentary by
Series: Abundant Truth International's Bible Reference Series. Price: $6.95 USD. Words: 5,430. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Biblical Commentary / Old Testament
In this commentary, we will examine one of the most important offerings of the Old Testament, the whole burnt offering.
The Book of Obadiah: The Evans Practical Bible Commentary by
Series: Abundant Truth International's Bible Reference Series. Price: $5.95 USD. Words: 3,400. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Biblical Commentary / Old Testament
In this commentary, we will examine the shortest book of the Old Testament; the prophecy of Obadiah. It serves as a warning to the nations of God's righteous judgment coming upon the earth. The Christian is reminded of God's faithfulness which will extend to His rule for all eternity.
A Kingdom of Priests: The Foundation for the Royal Priesthood of the Believer by
Series: Royal Priesthood Study Series. Price: $7.95 USD. Words: 6,930. Language: English. Published: July 1, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
The believer receives kingship and priesthood through Jesus. To have a people of a royal priesthood has always been a part of God's plan for His people. It was His desire for the children of Israel, yet He developed this desire in the believers. In the pages of the first book of this set, we will bring clarity to the foundation for the royal priesthood of the believer.
Interpreting Dreams and Visions: A Biblical Approach to Interpreting Dreams and Visions by
Series: Abundant Truth Spiritual Gifts Series. Price: $7.95 USD. Words: 4,570. Language: English. Published: April 5, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
When Jesus made us citizens of the Kingdom, it came with advantages. As members of the kingdom of God, we are eligible to partake of the outpouring of the Spirit. In the second book of this series, we will discuss the interpretation of dreams and visions. We will examine the different symbols of dreams and visions, and how to apply them in the Christian life.
The Way of Prayer: How to Pray for God's Protection and Deliverance by
Series: Prayer Studies Series. Price: $6.95 USD. Words: 4,380. Language: English. Published: March 19, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
Prayer is an essential component to the believer’s walk with the Lord. Through prayer Christians communicate with God and receive strength. Therefore, a consistent prayer life is important. In this book, we will examine Jehoshaphat's prayer for God's protection and deliverance and Asa’s prayer for God’s presence and strength.
The Art of Prayer: How to Pray for God's Presence and Strength by
Series: Prayer Studies Series. Price: $5.95 USD. Words: 3,930. Language: English. Published: March 19, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
Prayer is an essential component to the believer’s walk with the Lord. Through prayer Christians communicate with God and receive strength. Therefore, a consistent prayer life is important. In this book, we will examine Asa's prayer for God's presence and strength. His example should encourage us to call upon the name of the Lord in times of opposition and testing.
The Apostolic Paradigm Shift: Examining the Coming Reformation of Apostles and Apostolic Ministry by
Series: Ministerial Endowments Series. Price: $8.95 USD. Words: 10,550. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In this book, we will explain the apostolic paradigm shift God is sending in the Church.
The Fine Arts of Christian Living: Biblical Insights to a Successful Christian Life by
Series: Christian Living Series. Price: $8.95 USD. Words: 12,130. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In the pages of this book, we will discuss six areas that are important to successful Christian living. In mastering these 'Arts,' the Christian is able to live in the abundant life.
When God Says No: Understanding the Fatherhood of God by
Series: Prayer Studies Series. Price: $8.95 USD. Words: 13,240. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In the pages of this book, we want to explore reasons why the answer of God to us is not always right in our eyes. We will examine causes for the Lord denying the request of our hearts.
The Fine Arts of Christian Service: Biblical Insights for Fruitful Christian Service by
Series: Christian Living Series. Price: $5.95 USD. Words: 6,160. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In the pages of this book, we will discuss six areas that are important to fruitful Christian service. In mastering these 'Arts,' the Christian is able to become profitable members of the Body of Christ.
The Apostle Question: Exploring the Role of Apostles in the New Testament Church by
Series: Ministerial Endowments Series. Price: $11.95 USD. Words: 20,570. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
The focus of this book is to bring clarity and understanding to the role of the apostle in the Church. Sound biblical answers to questions concerning the function of the apostle are answered.
The Covenants Speak: An Examination of the Adamic and of the Noahic Covenants by
Series: Biblical Studies Series. Price: $8.95 USD. Words: 9,970. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In this book, we will explore two foundational to God's interaction with His creation; that is, the Adamic Covenant and the Noahic Covenant. As we explore these two Covenants, we will see God's eternal purpose revealed, as well as the relevance of these covenants for the Christian today.
The Mystery of the Thorn: A Study of Paul's Thorn in the Flesh by
Series: Kingdom Mystery Series. Price: $7.95 USD. Words: 7,620. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In this book, we will explore the mystery of the thorn in the flesh. Paul stated that God had given him a thorn in his flesh in order to keep him humble because of the revelation that was in his life. However, there has been much controversy over what the thorn in his flesh was, and how God could allow such a thing to exist.
For the Perfecting of the Saints: Exploring the Ministries of the Pastor and of the Teacher by
Series: Comparative Ministry Study Series. Price: $11.95 USD. Words: 18,790. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In the pages of this book, we will discuss the ministries of the pastor and of the teacher in detail. A proper understanding of these ministries will help individuals recognize and appreciate their functionality in the Church.
Out of Egypt into Canaan: Forgetting the Failures of the Past, Pressing Toward the Promises of God by
Series: Restoration and Recovery Series. Price: $8.95 USD. Words: 11,200. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion & Spirituality » Christianity
In this book, we will examine the failures and ultimate successes of biblical characters. If they overcame, then, the Christian today can come out of any personal Egypt and enter into their promised Canaan. Their examples provide hope and strength for the Christian today.
Back to profile overview

Abundant Truth Publishing's tag cloud

abundant    adam    adamic    african    africanamerican    american    anointing    answers    anthology    aposolic    apostle    apostles    apostlesprophetsprophetapostleapostolicfoundationchurchleadersministryprophetic    apostolic    apostolic ministry    ark    arts    asa    believe    bible    bible study    biblical    builders    burnt offering    call    canaan    care    chance    character    characters    charisma    charismatic    chasten    christ    christian    christian living    christianity    coming    commentary    concept    conduct    contemporary    corithians    correction    covenants    creation    day    deliverance    destiny    disciple    discipleship    discipline    dreams    egypt    elijah    endtimes    endurance    enoch    evans    factor    failure    faith    faithful    false teachers    father    fatherhood    fevefold    fine    fivefold    flesh    flood    forget    forgiveness    fruitful    galatians    garden    gift    gifts    god    god says no    growth    help    holiness    holy    hope    hymns    image    insights    inspirational    interpret    interpretation    jehoshaphat    jesus    journey    jude    king    kingdom    last    law    lazarus    leadership    led    lessons    leviticus    life    love    manasseh    mantle    melchizedek    mikhtam    mind    minister    ministering    ministers    ministry    modern    motives    new testament    no    noah    noahic    obadiah    office    our father    overcome    pain    paradigm shift    pastor    pastoral    patience    paul    pentecostal    perfecting    perseverance    philemon    poems    poet    poetical    poetry    praise    pray    prayer    precept    predestination    preparation    prepare    priest    priesthood    process    promises    prophecy    prophesy    prophetic    prophets    protection    pruning    psalms    rainbow    redeem    refined    reformation    repent    restoration    restore    reward    righteous    rl    roderick    roderickevanschristianlifeserviceministrysuccessfulabundanttruth    roles of apostles    royal    saints    sanctification    sanctuary    says    service    signs    sonship    soul    spirit    spiritual    strength    studies    study    success    suffering    symbols    teach    teacher    teachers    teaching    theory    thorn    titus    transformed    truth    understanding    victory    visions    walk    what is apostle    when    will of god    worship    worship leader