Roderick L. Evans

Biography

Roderick L. Evans is an author, bible lecturer, and Christian apologist. He is the founder of Abundant Truth International Ministries: a prophetic and a Christian apologetic ministry with the commission to defend, equip, and contend for Christ’s Kingdom. He is a prolific author, having written numerous books on topics such as Christian orthodoxy, leadership, worship, spiritual gifts, and other areas of Christian thought and practice; as well as, articles, blogs, sheet music, and poetry.

He travels nationally and internationally proclaiming the message of the Christian faith, equipping the Body of Christ for service, and imparting prophetic revelation through seminars, conferences, revivals, and other sacred services. His desire is to see the Church perfected through the truth of God revealed in Jesus Christ. He and his family reside in Elizabeth City, NC.

Smashwords Interview

When did you first start writing?
I first starting writing over 12 years ago in 2000.
What's the story behind your latest book?
My latest book was inspired by understanding that people need inspiration to make it through this life, especially during these times of social and economic uncertainties.
Read more of this interview.

Where to find Roderick L. Evans online


Where to buy in print


Books

The Spirit-Directed Organization: An Examination and Refutation of the Doctrines of the Jehovah’s Witness
Price: $2.99 USD. Words: 4,040. Language: English. Published: March 13, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / Apologetics, Nonfiction » Religion and Spirituality » Christianity / Jehovah’s Witnesses
In this publication, we will examine the doctrines of the Watchtower Society and provide Christians with orthodox biblical responses to their truth claims.
Shall We Continue in Sin?: An Examination of the Doctrine of Eternal Security
Price: $2.99 USD. Words: 4,150. Language: English. Published: March 13, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / Soteriology
In this publication, we will examine the doctrine of eternal security and its validity in Christian thought and practice.
Foundations in Trinitarian Thought and Theology: A Biblical Explanation of the Doctrine of the Trinity
Price: $4.95 USD. Words: 16,750. Language: English. Published: March 10, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / Apologetics
This book provides a practical defense and exposition of the biblical doctrine of the Trinity.
For I Desired Mercy: Biblical Reflections on Religion, Relationship, and Righteousness in Christianity
Price: $3.95 USD. Words: 15,050. Language: American English. Published: March 10, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
Since the earliest days of Christianity, there have been continual doctrinal battles concerning the faith. In this book, we will reflect on the correlation between religion, relationship, and righteousness in Christianity.
Pathway to Purpose (Volume II): Daily Inspiration for the Christian Journey
Series: Abundant Truth Devotionals. Price: $3.95 USD. Words: 8,030. Language: English. Published: January 15, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Devotional
The Pathway to Purpose Devotional comprises of 30 daily devotions developed from various scriptures. This devotional series is designed to give Christians faith and hope as they strive to fulfill their God-given purpose. In the end, the walk and life of the Christian, today, will be enhanced. Volume 2 of 3 .
Pathway to Purpose (Volume I): Daily Reflections for the Christian Journey
Series: Abundant Truth Devotionals. Price: $3.95 USD. Words: 8,950. Language: English. Published: January 15, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Devotional
The Pathway to Purpose Devotional comprises of 30 daily devotions developed from various scriptures. This devotional series is designed to give Christians faith and hope as they strive to fulfill their God-given purpose. In the end, the walk and life of the Christian, today, will be enhanced. Volume 1 of 3.
Faith for the Journey (Volume III): Daily Reflections for Christian Living
Series: Abundant Truth Devotionals. Price: $3.95 USD. Words: 9,080. Language: English. Published: January 15, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Devotional
The third volume of the Faith for the Journey Devotional comprises of 30 daily reflections developed from select bible verses. This devotional set is designed to help Christians understand that the just shall live by faith. In the end, the walk and life of the Christian, today, will be enhanced. Volume 3 of 3.
Faith for the Journey (Volume II): Daily Inspiration for Christian Living
Series: Abundant Truth Devotionals. Price: $3.95 USD. Words: 9,600. Language: English. Published: January 15, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Devotional
The second volume of the Faith for the Journey Devotional comprises of 30 daily inspirations developed from various scripture verses. This devotional set is designed to bring the Christian to a greater understanding of what it means to live by faith through application of the scriptures. In the end, the walk and life of the Christian, today, will be enhanced. Volume 2 of 3.
Faith for the Journey (Volume I): Daily Devotions for Christian Living
Series: Abundant Truth Devotionals. Price: $3.95 USD. Words: 9,750. Language: English. Published: January 15, 2015 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Devotional
The first volume of the Faith for the Journey Devotional comprises of 30 daily devotions developed from the life of Abraham, the father of faith. This devotional set is designed to bring the Christian face-to-face with himself and with Christ. In the end, the walk and life of the Christian, today, will be enhanced. Volume 1 of 3.
Kingdom Keys Deluxe Edition (4 Mini-Books in 1): Principles for Successful Christian Living
Series: Abundant Truth Deluxe Editions, Book 4. Price: $2.99 USD. Words: 6,800. Language: English. Published: September 2, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
Four informative publications concerning successful Christian life and service. From the library of Abundant Truth Publishing: Keys to Becoming a Worthy Christian, Keys to Patience, Keys to Understanding the Process, and Keys to Pastoral Ministry and Recovery
Prophetic Power Deluxe Edition (2 Books in 1): If They Be Prophets & The Prophetic Mantle
Series: Abundant Truth Deluxe Editions, Book 3. Price: $9.95 USD. Words: 31,150. Language: English. Published: August 26, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / Pneumatology, Nonfiction » Religion and Spirituality » Christian Ministry / General
Two informative books concerning prophets, prophetic ministry, and prophetic operations! From the library of Abundant Truth Publishing: If They Be Prophets & The Prophetic Mantle.
Covenant Studies 101: Foundational Lessons from the Adamic and the Noahic Covenants
Price: $3.95 USD. Words: 9,920. Language: English. Published: August 25, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Criticism & Interpretation / Old Testament, Nonfiction » Religion and Spirituality » Christian Life / Spiritual Growth
The covenants still provide valuable lessons for the Christian today. In this study, we will explore two foundational covenants to God’s interaction with His creation. We will examine the Adamic and the Noahic Covenants.
Royal Priesthood Studies 101: Introductory Studies to the Priesthood of the Believer
Price: $3.95 USD. Words: 12,260. Language: English. Published: August 24, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Criticism & Interpretation / General, Nonfiction » Religion and Spirituality » Christian Theology / General
In the pages of this study, we will provide foundational truth concerning the royal priesthood of the believer.
Pastoral and Teaching Ministries 101: Biblical Studies for the Ministries of the Pastor and of the Teacher
Price: $6.95 USD. Words: 16,590. Language: English. Published: August 23, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General, Nonfiction » Religion and Spirituality » Christian Ministry / Pastoral Resources
In the pages of this study, we will discuss the ministries of the pastor and of the teacher in detail.
Power of the Spirit Deluxe Edition (2 Books in 1): The Spiritual Gifts & Dreams and Visions
Series: Abundant Truth Deluxe Editions, Book 2. Price: $8.95 USD. Words: 21,850. Language: English. Published: August 19, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / Pneumatology
Two enlightening books concerning dreams, visions, and spiritual gifts in one edition! From the library of Abundant Truth Publishing: The Spiritual Gifts & Dreams and Visions
Apostolic Authority Deluxe Edition (2 Books in 1): The Apostle Question & The Apostolic Paradigm Shift
Series: Abundant Truth Deluxe Editions, Book 1. Price: $8.95 USD. Words: 30,400. Language: English. Published: August 19, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
Two powerful books concerning apostolic ministry in one edition! From the library of Abundant Truth Publishing: The Apostle Question & The Apostolic Paradigm Shift.
The God of Another Chance: Overcoming Your Failures, Possessing Your Divine Destiny
Price: $4.95 USD. Words: 18,730. Language: English. Published: August 18, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this book, we will examine the failures and ultimate successes of biblical characters.
Christian Discipleship 101: Lessons for Spiritual Growth and Maturity in the Christian Life
Price: $3.95 USD. Words: 7,680. Language: English. Published: August 12, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Spiritual Growth, Nonfiction » Religion and Spirituality » Christian Ministry / Discipleship
In this study, we will examine three parables: the parables of the hidden treasure, the pearl of great price, and the unmerciful servant. As we learn from these parables, we will stay on the path to true discipleship.
The Successful Christian 101: Twelve Lessons for Mastering the Art of Christian Life and Service
Price: $6.95 USD. Words: 18,310. Language: English. Published: August 7, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Spiritual Growth
In the pages of this study, we will discuss twelve areas that are important to successful Christian living. In mastering these areas, the Christian is able to live in the abundant life.
Apostolic and Prophetic Foundations 101: Foundational Studies for the Apostolic and the Prophetic Ministries
Price: $6.95 USD. Words: 25,310. Language: English. Published: August 5, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Church / Leadership
The focus of this teaching and study material is to bring clarity and understanding to the apostolic and prophetic offices.
The Prophetic Mantle: The Gift of Prophecy and Prophetic Operations in the Church Today
Series: Spiritual Gifts. Price: $4.95 USD. Words: 15,050. Language: American English. Published: August 4, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / Pneumatology, Nonfiction » Religion and Spirituality » Christian Life / Inspirational
The focus of this book is to bring clarity to the gift of prophecy, prophetic operations, and to the pitfalls associated with prophetic ministry.
The Teaching Ministry: An Introduction to the Teaching Office and Gift
Series: Spiritual Gifts. Price: $0.99 USD. Words: 4,360. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
The focus of this book is to bring clarity and understanding to the teaching office and the teaching anointing.
The Pastoral Ministry: An Introduction to the Pastoral Office and Gift
Series: Spiritual Gifts. Price: $0.99 USD. Words: 4,570. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
The focus of this book is to bring clarity and understanding to the pastoral office and the pastoral anointing.
The Lazarus Effect: Experiencing a Personal Resurrection
Price: $2.99 USD. Words: 5,940. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this book, learn how you can experience a Lazarus Effect in your personal life.
The Doctrine of Sanctification: Understanding Sanctification and Holiness in the Christian Life
Series: Kingdom Discipleship. Price: $0.99 USD. Words: 2,770. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this issue, we will discuss the doctrine of sanctification and its place in the Christian s life. In addition, we will explore the conditional and positional aspects of sanctification and its relationship to holiness.
Walk in the Spirit: Biblical Studies in Christian Conduct
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,120. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
God has a standard of living that we, as believers, must live by. However, we must remember that our good works and acts must be a product of Christ’s character being formed in us. In this publication, we will examine the proper conduct for the Christian.
The Chastening of the Lord: Biblical Studies in God's Discipline
Series: Kingdom Citizens. Price: $0.99 USD. Words: 2,770. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will look closely at the place of God’s discipline in the Christian Life.
Let This Mind Be In You: Biblical Studies in Christian Character
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,510. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss Kingdom Character. We will examine the appropriate character of the Christian.
No Man Knows the Hour: Biblical Studies in the Coming Kingdom
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,410. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss the coming Kingdom of heaven.
Conformed to His Image: Biblical Studies in Predestination
Series: Kingdom Citizens. Price: $0.99 USD. Words: 2,230. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss the predestination of God. When we speak of predestination in this publication, we are referring to what God has intended or purposed for your life.
Enoch, the Righteous: A Brief Expository of the Man Who Pleased God
Series: Biblical Character Studies. Price: $2.99 USD. Words: 2,890. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Studies / Bible Study Guides
In this publication, we will explore the life of Enoch. Through his example, we will learn how to please the Lord in our walk with him.
Manasseh, the Repentant: A Brief Expository of the Forgetful King
Series: Biblical Character Studies. Price: $2.99 USD. Words: 4,940. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / General
In this publication, we will explore the life of Manasseh, the son of Hezekiah. It is our hope that this story will challenge believers to forsake anything that displeases the Lord.
Motives in Ministry: Defining the Proper Motives for Ministry and Service
Series: Christian Leadership. Price: $2.99 USD. Words: 5,450. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
In this brief study, we will examine the proper motives for Christian ministry and service; and also motives to avoid.
Study to Show Yourself Approved: Exploring Christian Concepts for Victorious Living
Series: Christian Inspirational Lessons. Price: $0.99 USD. Words: 7,720. Language: English. Published: October 17, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Inspirational
In this book, we have compiled select teachings and exhortations to help the Christian become the proverbial master of his domain.
The Walk of Faith: Exploring Christian Precepts for Victorious Living
Series: Christian Inspirational Lessons. Price: $0.99 USD. Words: 7,900. Language: English. Published: October 17, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Inspirational
In this book, we have compiled select teachings and exhortations to transform the Christian's walk with Christ.
Troubled on Every Side: How God Uses People and Problems to Prepare Us for Ministry and Service
Series: Christian Leadership. Price: $2.99 USD. Words: 3,960. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
In the pages of this book, we will discuss how God uses problematic people and situations to prepare us before and during ministry for effective service.
The Prophetic Ministry: Exploring the Prophetic Office and Gift
Series: Spiritual Gifts. Price: $0.99 USD. Words: 10,560. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
This publication presents a solid introduction to the prophetic ministry. It will bring clarity and understanding to the prophetic office, the prophetic anointing, and the gift of prophecy.
The Apostolic Ministry: Exploring the Apostolic Office and Gift
Series: Spiritual Gifts. Price: $0.99 USD. Words: 9,480. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
This publication presents a solid introduction to the apostolic ministry. It will bring clarity and understanding to the apostolic office, the apostolic anointing, and apostleship.
The Mystery of Sonship: Exploring the Relationship between Salvation, Servant-hood, and Sonship
Series: Kingdom Mystery. Price: $2.99 USD. Words: 5,980. Language: English. Published: April 16, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Studies / Paul’s Letters
In this book, we will explore the mystery of sonship. Our salvation does not only entitle us to right-standing with God, but also relationship.
The Epistle of Titus: The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 4,870. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, we will examine one of the pastoral letters of Paul. In his epistle to Titus, the Christian learns of the controversies and challenges facing the early church. The Christian is reminded to be demonstrators of the gospel message in private and public affairs. In doing so, the gospel of Christ is adorned.
The Epistle of Philemon: The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 3,950. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, learn valuable lessons for the Christian faith. Paul's epistle to Philemon reminds Christians of the respect that should be present in the Church.
The Epistle of Jude: The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 5,290. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, discover practical truths for the Christian life. Jude wrote to warn the believers against false brethren and to challenge them to contend for the faith of Jesus Christ.
Leviticus 1 (The Burnt Offering): The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 4,540. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / Old Testament
In this commentary, we will examine one of the most important offerings of the Old Testament, the whole burnt offering.
The Book of Obadiah: The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 3,180. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / Old Testament
In this commentary, we will examine the shortest book of the Old Testament; the prophecy of Obadiah. It serves as a warning to the nations of God's righteous judgment coming upon the earth. The Christian is reminded of God's faithfulness which will extend to His rule for all eternity.
The Way of Prayer: How to Pray for God's Protection and Deliverance
Series: Prayer. Price: $2.99 USD. Words: 8,040. Language: English. Published: March 19, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
Prayer is an essential component to the believer’s walk with the Lord. Through prayer Christians communicate with God and receive strength. Therefore, a consistent prayer life is important. In this book, we will examine Jehoshaphat's prayer for God's protection and deliverance and Asa’s prayer for God’s presence and strength.
The Apostolic Paradigm Shift: Examining the Coming Reformation of Apostles and Apostolic Ministry
Price: $3.95 USD. Words: 10,460. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, we will explain the apostolic paradigm shift God is sending in the Church.
When God Says No: Understanding the Fatherhood of God
Price: $3.95 USD. Words: 13,160. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In the pages of this book, we want to explore reasons why the answer of God to us is not always right in our eyes. We will examine causes for the Lord denying the request of our hearts.
The World, The Flesh, and The Devil: Practical Insights to Living Victoriously in Christ
Price: $2.99 USD. Words: 23,890. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
The World, The Flesh, and The Devil provides guidelines for overcoming the three battlegrounds every Christian faces: the world, the flesh, and the devil. Learn how you can walk in the power of God. Discover how you, too, can live victoriously in Christ.
The Apostle Question: Exploring the Role of Apostles in the New Testament Church
Price: $4.95 USD. Words: 20,480. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
The focus of this book is to bring clarity and understanding to the role of the apostle in the Church. Sound biblical answers to questions concerning the function of the apostle are answered.
Be Strong... Be Men: Responding to the Christian Call to Manhood
Series: Christian Men's Studies, Book 1. Price: $2.99 USD. Words: 9,590. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Men’s Issues
In this book, we will explore what defines the Christian male. It is time for Christian men to rise to the challenge of following Christ as true disciples and demonstrators of His grace, peace, and power.
View more...

Roderick L. Evans' tag cloud

abraham    abundant    abundant truth    adam    anointing    answers    apologetics    aposolic    apostle    apostles    apostlesprophetsprophetapostleapostolicfoundationchurchleadersministryprophetic    apostolic    apostolic ministry    believe    believer    bible    bible study    builders    burnt offering    chance    character    characters    charisma    charismatic    chasten    christ    christian    christian living    christianity    coming    commentary    concept    conduct    corithians    correction    covenant    creation    day    defense    deliverance    destiny    devil    devotional    disciple    discipleship    discipline    doctrine    doctrines    dream    elijah    endtimes    enoch    eternal security    evans    failure    faith    false    false teachers    father    fatherhood    fevefold    fivefold    flesh    forgiveness    galatians    gift    gifts    god    god says no    godhead    growth    healing    holiness    holy    hope    i corinthians 12    image    inspirational    jehoshaphat    jehovah    jesus    journey    jude    keys    king    kingdom    last    law    lazarus    leadership    led    lessons    leviticus    life    life in christ    living    logos    love    man    manasseh    mantle    married    melchizedek    men studies    mind    minister    ministering    ministers    ministry    motives    no    noah    obadiah    office    our father    overcome    paradigm shift    pastor    pastoral    pathway    paul    pentecostal    peter    philemon    power    pray    prayer    precept    predestination    prepare    priesthood    prophecy    prophesy    prophetic    prophets    protection    pseudo christian    purpose    rainbow    redeem    reflections    reformation    refute    relationship    religion    repent    restoration    restore    reward    righteous    roderick    roderickevanschristianlifeserviceministrysuccessfulabundanttruth    roles of apostles    royal    salvation    sanctification    says    service    signs    sonship    spirit    strength    studies    study    teach    teacher    teachers    teaching    titus    tongues prophecy    transformed    tree of life    trinitarian    trinity    truth    victory    visions    walk    warfare    what is apostle    when    will of god    witness    world