Roderick L. Evans

Biography

Roderick L. Evans is an author, bible lecturer, and Christian apologist. He is the founder of Abundant Truth International Ministries: a prophetic and a Christian apologetic ministry with the commission to defend, equip, and contend for Christ’s Kingdom. He is a prolific author, having written numerous books on topics such as Christian orthodoxy, leadership, worship, spiritual gifts, and other areas of Christian thought and practice; as well as, articles, blogs, sheet music, and poetry.

He travels nationally and internationally proclaiming the message of the Christian faith, equipping the Body of Christ for service, and imparting prophetic revelation through seminars, conferences, revivals, and other sacred services. His desire is to see the Church perfected through the truth of God revealed in Jesus Christ. He and his family reside in Elizabeth City, NC.

Smashwords Interview

When did you first start writing?
I first starting writing over 12 years ago in 2000.
What's the story behind your latest book?
My latest book was inspired by understanding that people need inspiration to make it through this life, especially during these times of social and economic uncertainties.
Read more of this interview.

Where to find Roderick L. Evans online


Where to buy in print


Books

Dreams and Visions: A Biblical Perspective to Understanding Dreams and Visions
Price: $3.95 USD. Words: 13,020. Language: English. Published: August 30, 2010 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, we will discuss the various aspects of dreams and visions. We will examine the different types of dreams and visions; how to interpret dreams, and how to apply them to our lives.
He Gave Gifts Unto Men: God's Plan for Ministry in the Kingdom
Series: Christian Leadership. Price: $2.99 USD. Words: 7,700. Language: English. Published: August 30, 2010 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
Ministry is a valuable part of the Kingdom. God anoints individuals in the Church with ministries and gifts to glorify Him. However, as the day of the Lord hastens, we find many believers entering into ministry with wrong motives. In addition, others are pursuing gifts for their own personal gain. This publication will give believers a pure perspective for ministry.
I Will Give You Pastors: Examining the Pastoral Office in the New Testament Church
Price: $4.95 USD. Words: 14,290. Language: English. Published: September 3, 2010 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
The focus of this book is to bring clarity and understanding to the ministry of the pastor. This information will help individuals to recognize the operation of this gift in their lives and in the lives of others. It is our hope that believers will develop a greater respect and appreciation for the pastoral office and gift.
Kingdom Concepts: Examining the Dynamics of Kingdom Living
Price: $0.99 USD. Words: 12,950. Language: English. Published: November 7, 2010 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
This second book of the life in the kingdom series is a book about Kingdom Concepts. We are a part of the Kingdom of God now and will be partakers of the glory of the Kingdom of God at Christ's return. Rejoice and be glad for the Kingdom of heaven belongs to you. Book 2 of 2.
Now Concerning Teachers: Establishing the Role of the Teacher in the Body of Christ
Price: $4.95 USD. Words: 12,430. Language: English. Published: November 7, 2010 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
The focus of this book is to bring clarity and understanding to the ministry of the teacher.
Precepts for Kingdom Living: Protocols and Perspectives in the Kingdom of God
Price: $0.99 USD. Words: 12,650. Language: English. Published: November 7, 2010 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
The kingdom of God is revealed through the acceptance of Jesus Christ. He told Nicodemus that unless one is born again, he cannot see the kingdom of God. However, those who have received Christ are members of the kingdom of God. There are standards and protocols that exist in the kingdom of God. In this book, we will explore seven foundational truths concerning the kingdom of God. Book 1 of 2.
Samson, the Nazarite: A Brief Expository of God's Strong Man
Series: Biblical Character Studies. Price: $2.99 USD. Words: 6,680. Language: English. Published: November 7, 2010 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, we will explore the life of Samson, the Nazarite. Believers can learn from his mistakes and emulate his successes.
The Call to Serve: An Examination of the Deacon and Servant's Ministry in the Church
Series: Christian Men's Studies, Book 2. Price: $2.99 USD. Words: 7,440. Language: English. Published: November 7, 2010 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, we will examine the history and subsequent development of the Deacon's office in the Church. In addition, we will learn how the first men who were appointed to serve in the Church are the standard for which deacons and servants are to evaluate their service today. In doing so, the Church, deacons, and those called to serve will benefit from mutual understanding and cooperation.
The Spiritual Gifts: A Biblical Explanation of the Gifts of the Spirit
Price: $2.99 USD. Words: 9,530. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, we will take a biblical approach to examining and explaining the gifts and ministries of the Spirit, their functions, and how to recognize them in operation.
The Christian Teen's Guide to Relationships: Exploring Issues and Answers for Healthy Relationships
Price: $2.99 USD. Words: 5,910. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, we will discuss relationships and the Christian teen. The Christian teen will discover how to have positive and wholesome friendships and relationships.
If They Be Prophets: Rediscovering the Ministry of the Prophet in the New Testament Church
Price: $4.95 USD. Words: 16,700. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, rediscover the ministry of the New Testament prophet and how it operates in today's Church.
The Mystery of the Thorn: A Study of Paul's Thorn in the Flesh
Series: Kingdom Mystery. Price: $3.95 USD. Words: 7,610. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, we will explore the mystery of the thorn in the flesh. Paul stated that God had given him a thorn in his flesh in order to keep him humble because of the revelation that was in his life. However, there has been much controversy over what the thorn in his flesh was, and how God could allow such a thing to exist.
Be Strong... Be Men: Responding to the Christian Call to Manhood
Series: Christian Men's Studies, Book 1. Price: $2.99 USD. Words: 9,590. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Men’s Issues
In this book, we will explore what defines the Christian male. It is time for Christian men to rise to the challenge of following Christ as true disciples and demonstrators of His grace, peace, and power.
The Apostle Question: Exploring the Role of Apostles in the New Testament Church
Price: $4.95 USD. Words: 20,480. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
The focus of this book is to bring clarity and understanding to the role of the apostle in the Church. Sound biblical answers to questions concerning the function of the apostle are answered.
The World, The Flesh, and The Devil: Practical Insights to Living Victoriously in Christ
Price: $2.99 USD. Words: 23,890. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
The World, The Flesh, and The Devil provides guidelines for overcoming the three battlegrounds every Christian faces: the world, the flesh, and the devil. Learn how you can walk in the power of God. Discover how you, too, can live victoriously in Christ.
When God Says No: Understanding the Fatherhood of God
Price: $3.95 USD. Words: 13,160. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In the pages of this book, we want to explore reasons why the answer of God to us is not always right in our eyes. We will examine causes for the Lord denying the request of our hearts.
The Apostolic Paradigm Shift: Examining the Coming Reformation of Apostles and Apostolic Ministry
Price: $3.95 USD. Words: 10,460. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
In this book, we will explain the apostolic paradigm shift God is sending in the Church.
The Way of Prayer: How to Pray for God's Protection and Deliverance
Series: Prayer. Price: $2.99 USD. Words: 8,040. Language: English. Published: March 19, 2011 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christianity
Prayer is an essential component to the believer’s walk with the Lord. Through prayer Christians communicate with God and receive strength. Therefore, a consistent prayer life is important. In this book, we will examine Jehoshaphat's prayer for God's protection and deliverance and Asa’s prayer for God’s presence and strength.
The Book of Obadiah: The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 3,180. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / Old Testament
In this commentary, we will examine the shortest book of the Old Testament; the prophecy of Obadiah. It serves as a warning to the nations of God's righteous judgment coming upon the earth. The Christian is reminded of God's faithfulness which will extend to His rule for all eternity.
Leviticus 1 (The Burnt Offering): The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 4,540. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / Old Testament
In this commentary, we will examine one of the most important offerings of the Old Testament, the whole burnt offering.
The Epistle of Jude: The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 5,290. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, discover practical truths for the Christian life. Jude wrote to warn the believers against false brethren and to challenge them to contend for the faith of Jesus Christ.
The Epistle of Philemon: The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 3,950. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, learn valuable lessons for the Christian faith. Paul's epistle to Philemon reminds Christians of the respect that should be present in the Church.
The Epistle of Titus: The Evans Practical Bible Commentary
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 4,870. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, we will examine one of the pastoral letters of Paul. In his epistle to Titus, the Christian learns of the controversies and challenges facing the early church. The Christian is reminded to be demonstrators of the gospel message in private and public affairs. In doing so, the gospel of Christ is adorned.
The Mystery of Sonship: Exploring the Relationship between Salvation, Servant-hood, and Sonship
Series: Kingdom Mystery. Price: $2.99 USD. Words: 5,980. Language: English. Published: April 16, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Studies / Paul’s Letters
In this book, we will explore the mystery of sonship. Our salvation does not only entitle us to right-standing with God, but also relationship.
The Apostolic Ministry: Exploring the Apostolic Office and Gift
Series: Spiritual Gifts. Price: $0.99 USD. Words: 9,480. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
This publication presents a solid introduction to the apostolic ministry. It will bring clarity and understanding to the apostolic office, the apostolic anointing, and apostleship.
The Prophetic Ministry: Exploring the Prophetic Office and Gift
Series: Spiritual Gifts. Price: $0.99 USD. Words: 10,560. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
This publication presents a solid introduction to the prophetic ministry. It will bring clarity and understanding to the prophetic office, the prophetic anointing, and the gift of prophecy.
Troubled on Every Side: How God Uses People and Problems to Prepare Us for Ministry and Service
Series: Christian Leadership. Price: $2.99 USD. Words: 3,960. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
In the pages of this book, we will discuss how God uses problematic people and situations to prepare us before and during ministry for effective service.
The Walk of Faith: Exploring Christian Precepts for Victorious Living
Series: Christian Inspirational Lessons. Price: $0.99 USD. Words: 7,900. Language: English. Published: October 17, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Inspirational
In this book, we have compiled select teachings and exhortations to transform the Christian's walk with Christ.
Study to Show Yourself Approved: Exploring Christian Concepts for Victorious Living
Series: Christian Inspirational Lessons. Price: $0.99 USD. Words: 7,720. Language: English. Published: October 17, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Inspirational
In this book, we have compiled select teachings and exhortations to help the Christian become the proverbial master of his domain.
Motives in Ministry: Defining the Proper Motives for Ministry and Service
Series: Christian Leadership. Price: $2.99 USD. Words: 5,450. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
In this brief study, we will examine the proper motives for Christian ministry and service; and also motives to avoid.
Manasseh, the Repentant: A Brief Expository of the Forgetful King
Series: Biblical Character Studies. Price: $2.99 USD. Words: 4,940. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / General
In this publication, we will explore the life of Manasseh, the son of Hezekiah. It is our hope that this story will challenge believers to forsake anything that displeases the Lord.
Enoch, the Righteous: A Brief Expository of the Man Who Pleased God
Series: Biblical Character Studies. Price: $2.99 USD. Words: 2,890. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Studies / Bible Study Guides
In this publication, we will explore the life of Enoch. Through his example, we will learn how to please the Lord in our walk with him.
Conformed to His Image: Biblical Studies in Predestination
Series: Kingdom Citizens. Price: $0.99 USD. Words: 2,230. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss the predestination of God. When we speak of predestination in this publication, we are referring to what God has intended or purposed for your life.
No Man Knows the Hour: Biblical Studies in the Coming Kingdom
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,410. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss the coming Kingdom of heaven.
Let This Mind Be In You: Biblical Studies in Christian Character
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,510. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss Kingdom Character. We will examine the appropriate character of the Christian.
The Chastening of the Lord: Biblical Studies in God's Discipline
Series: Kingdom Citizens. Price: $0.99 USD. Words: 2,770. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will look closely at the place of God’s discipline in the Christian Life.
Walk in the Spirit: Biblical Studies in Christian Conduct
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,120. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
God has a standard of living that we, as believers, must live by. However, we must remember that our good works and acts must be a product of Christ’s character being formed in us. In this publication, we will examine the proper conduct for the Christian.
The Doctrine of Sanctification: Understanding Sanctification and Holiness in the Christian Life
Series: Kingdom Discipleship. Price: $0.99 USD. Words: 2,770. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this issue, we will discuss the doctrine of sanctification and its place in the Christian s life. In addition, we will explore the conditional and positional aspects of sanctification and its relationship to holiness.
The Lazarus Effect: Experiencing a Personal Resurrection
Price: $2.99 USD. Words: 5,940. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this book, learn how you can experience a Lazarus Effect in your personal life.
The Pastoral Ministry: An Introduction to the Pastoral Office and Gift
Series: Spiritual Gifts. Price: $0.99 USD. Words: 4,570. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
The focus of this book is to bring clarity and understanding to the pastoral office and the pastoral anointing.
The Teaching Ministry: An Introduction to the Teaching Office and Gift
Series: Spiritual Gifts. Price: $0.99 USD. Words: 4,360. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
The focus of this book is to bring clarity and understanding to the teaching office and the teaching anointing.
The Prophetic Mantle: The Gift of Prophecy and Prophetic Operations in the Church Today
Series: Spiritual Gifts. Price: $4.95 USD. Words: 15,050. Language: American English. Published: August 4, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / Pneumatology, Nonfiction » Religion and Spirituality » Christian Life / Inspirational
The focus of this book is to bring clarity to the gift of prophecy, prophetic operations, and to the pitfalls associated with prophetic ministry.
Apostolic and Prophetic Foundations 101: Foundational Studies for the Apostolic and the Prophetic Ministries
Price: $6.95 USD. Words: 25,310. Language: English. Published: August 5, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Church / Leadership
The focus of this teaching and study material is to bring clarity and understanding to the apostolic and prophetic offices.
The Successful Christian 101: Twelve Lessons for Mastering the Art of Christian Life and Service
Price: $6.95 USD. Words: 18,310. Language: English. Published: August 7, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Spiritual Growth
In the pages of this study, we will discuss twelve areas that are important to successful Christian living. In mastering these areas, the Christian is able to live in the abundant life.
Christian Discipleship 101: Lessons for Spiritual Growth and Maturity in the Christian Life
Price: $3.95 USD. Words: 7,680. Language: English. Published: August 12, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / Spiritual Growth, Nonfiction » Religion and Spirituality » Christian Ministry / Discipleship
In this study, we will examine three parables: the parables of the hidden treasure, the pearl of great price, and the unmerciful servant. As we learn from these parables, we will stay on the path to true discipleship.
The God of Another Chance: Overcoming Your Failures, Possessing Your Divine Destiny
Price: $4.95 USD. Words: 18,730. Language: English. Published: August 18, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Life / General
In this book, we will examine the failures and ultimate successes of biblical characters.
Apostolic Authority Deluxe Edition (2 Books in 1): The Apostle Question & The Apostolic Paradigm Shift
Series: Abundant Truth Deluxe Editions, Book 1. Price: $8.95 USD. Words: 30,400. Language: English. Published: August 19, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General
Two powerful books concerning apostolic ministry in one edition! From the library of Abundant Truth Publishing: The Apostle Question & The Apostolic Paradigm Shift.
Power of the Spirit Deluxe Edition (2 Books in 1): The Spiritual Gifts & Dreams and Visions
Series: Abundant Truth Deluxe Editions, Book 2. Price: $8.95 USD. Words: 21,850. Language: English. Published: August 19, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Theology / Pneumatology
Two enlightening books concerning dreams, visions, and spiritual gifts in one edition! From the library of Abundant Truth Publishing: The Spiritual Gifts & Dreams and Visions
Pastoral and Teaching Ministries 101: Biblical Studies for the Ministries of the Pastor and of the Teacher
Price: $6.95 USD. Words: 16,590. Language: English. Published: August 23, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Christian Ministry / General, Nonfiction » Religion and Spirituality » Christian Ministry / Pastoral Resources
In the pages of this study, we will discuss the ministries of the pastor and of the teacher in detail.
Royal Priesthood Studies 101: Introductory Studies to the Priesthood of the Believer
Price: $3.95 USD. Words: 12,260. Language: English. Published: August 24, 2014 by Abundant Truth Publishing. Categories: Nonfiction » Religion and Spirituality » Biblical Criticism & Interpretation / General, Nonfiction » Religion and Spirituality » Christian Theology / General
In the pages of this study, we will provide foundational truth concerning the royal priesthood of the believer.
View more...

Roderick L. Evans' tag cloud

abundant    abundant truth    anointing    answers    aposolic    apostle    apostles    apostlesprophetsprophetapostleapostolicfoundationchurchleadersministryprophetic    apostolic    apostolic ministry    assembly    believe    believer    bible    bible study    biblical    builders    burnt offering    call    chance    character    characters    charisma    charismatic    chasten    christ    christian    church    coming    commentary    concept    conduct    corithians    correction    creation    dating    day    deacon    delilah    deliverance    destiny    devil    disciple    discipleship    discipline    divine    dream    dreams    dynamics    elijah    endtimes    enoch    evans    expository    failure    faith    false teachers    father    fatherhood    fevefold    fivefold    fivefold ministry    flesh    forgiveness    galatians    gift    gifts    god    god says no    groups    growth    healing    healthy    holiness    holy    hope    i corinthians 12    image    inspirational    interpretation    interpreting    jehoshaphat    jesus    jude    king    kingdom    last    law    lazarus    leader    leadership    led    leviticus    life    living    love    man    manasseh    mantle    married    melchizedek    men studies    mind    minister    ministering    ministers    ministry    ministry gift    motives    nature    nazarite    new    no    obadiah    office    our father    overcome    pain    parables    paradigm shift    partakers    pastor    pastoral    paul    pentecostal    perspectives    peter    philemon    pray    prayer    precept    precepts    predestination    prepare    priesthood    prophecy    prophesy    prophet    prophetic    prophetic ministry    prophets    protection    protocols    redeem    reformation    relationships    repent    restoration    restore    reward    righteous    roderick    roderickevanschristianlifeserviceministrysuccessfulabundanttruth    roles of apostles    royal    samson    sanctification    says    servant    serve    service    shepherd    signs    sonship    spirit    strength    strong    studies    study    suffering    symbols    teach    teacher    teachers    teaching    teen    testament    theory    thorn    titus    tongues    tongues prophecy    transformed    truth    truths    understanding    victory    visions    walk    warfare    what is apostle    when    wholesome    will of god    world    youth ministry