Roderick L. Evans

Biography

Roderick Levi Evans is an author, bible lecturer, and Christian apologist. He is the founder of Abundant Truth International Ministries: a prophetic and a Christian apologetic ministry with the commission to defend, equip, and contend for Christ’s Kingdom. He is a prolific author, having written numerous books on topics such as Christian orthodoxy, leadership, worship, spiritual gifts, and other areas of Christian thought and practice; as well as, articles, blogs, sheet music, and poetry.

He is the author of two popular blogs, "On D.E.C.K. with Roderick…" and "Moments of Truth," which provide relevant spiritual insights through biblical inspiration.

He travels nationally and internationally proclaiming the message of the Christian faith, equipping the Body of Christ for service, and imparting prophetic revelation through seminars, conferences, revivals, and other sacred services. His desire is to see the Church perfected through the truth of God revealed in Jesus Christ. He and his family reside in Elizabeth City, NC.

Smashwords Interview

When did you first start writing?
I first starting writing over 12 years ago in 2000.
What's the story behind your latest book?
My latest book was inspired by understanding that people need inspiration to make it through this life, especially during these times of social and economic uncertainties.
Read more of this interview.

Where to find Roderick L. Evans online


Where to buy in print


Books

Kingdom Keys Deluxe Edition (4 Mini-Books in 1): Principles for Successful Christian Living
By
Series: Abundant Truth Deluxe Editions, Book 4. Price: $2.99 USD. Words: 6,800. Language: English. Published: September 2, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
Four informative publications concerning successful Christian life and service. From the library of Abundant Truth Publishing: Keys to Becoming a Worthy Christian, Keys to Patience, Keys to Understanding the Process, and Keys to Pastoral Ministry and Recovery
Covenant Studies 101: Foundational Lessons from the Adamic and the Noahic Covenants
By
Price: $3.95 USD. Words: 9,920. Language: English. Published: August 25, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Criticism & Interpretation / Old Testament
The covenants still provide valuable lessons for the Christian today. In this study, we will explore two foundational covenants to God’s interaction with His creation. We will examine the Adamic and the Noahic Covenants.
Royal Priesthood Studies 101: Introductory Studies to the Priesthood of the Believer
By
Price: $3.95 USD. Words: 12,260. Language: English. Published: August 24, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Criticism & Interpretation / General
In the pages of this study, we will provide foundational truth concerning the royal priesthood of the believer.
Pastoral and Teaching Ministries 101: Biblical Studies for the Ministries of the Pastor and of the Teacher
By
Price: $6.95 USD. Words: 16,590. Language: English. Published: August 23, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Ministry / General
In the pages of this study, we will discuss the ministries of the pastor and of the teacher in detail.
The God of Another Chance: Overcoming Your Failures, Possessing Your Divine Destiny
By
Price: $4.95 USD. Words: 18,730. Language: English. Published: August 18, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
In this book, we will examine the failures and ultimate successes of biblical characters.
Christian Discipleship 101: Lessons for Spiritual Growth and Maturity in the Christian Life
By
Price: $3.95 USD. Words: 7,680. Language: English. Published: August 12, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / Spiritual Growth
In this study, we will examine three parables: the parables of the hidden treasure, the pearl of great price, and the unmerciful servant. As we learn from these parables, we will stay on the path to true discipleship.
The Successful Christian 101: Twelve Lessons for Mastering the Art of Christian Life and Service
By
Price: $6.95 USD. Words: 18,310. Language: English. Published: August 7, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / Spiritual Growth
In the pages of this study, we will discuss twelve areas that are important to successful Christian living. In mastering these areas, the Christian is able to live in the abundant life.
Apostolic and Prophetic Foundations 101: Foundational Studies for the Apostolic and the Prophetic Ministries
By
Price: $6.95 USD. Words: 25,310. Language: English. Published: August 5, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Church / Leadership
The focus of this teaching and study material is to bring clarity and understanding to the apostolic and prophetic offices.
The Prophetic Mantle: The Gift of Prophecy and Prophetic Operations in the Church Today
By
Series: Spiritual Gifts. Price: $4.95 USD. Words: 15,040. Language: American English. Published: August 4, 2014 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Theology / Pneumatology
The focus of this book is to bring clarity to the gift of prophecy, prophetic operations, and to the pitfalls associated with prophetic ministry.
The Watchtower Society: Examining the Doctrines of the Jehovah’s Witness
By
Series: Kingdom Contenders. Price: $2.99 USD. Words: 2,570. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Theology / Apologetics
In this publication, we will explore the belief system of the Jehovah’s Witness and the Watchtower Society.
The Teaching Ministry: An Introduction to the Teaching Office and Gift
By
Series: Spiritual Gifts. Price: $0.99 USD. Words: 4,320. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Ministry / General
The focus of this book is to bring clarity and understanding to the teaching office and the teaching anointing.
The Pastoral Ministry: An Introduction to the Pastoral Office and Gift
By
Series: Spiritual Gifts. Price: $0.99 USD. Words: 4,530. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Ministry / General
The focus of this book is to bring clarity and understanding to the pastoral office and the pastoral anointing.
The Lazarus Effect: Experiencing a Personal Resurrection
By
Price: $2.99 USD. Words: 5,940. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
In this book, learn how you can experience a Lazarus Effect in your personal life.
The Doctrine of Sanctification: Understanding Sanctification and Holiness in the Christian Life
By
Series: Kingdom Discipleship. Price: $0.99 USD. Words: 2,770. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
In this issue, we will discuss the doctrine of sanctification and its place in the Christian s life. In addition, we will explore the conditional and positional aspects of sanctification and its relationship to holiness.
Angels of Deception: Recognizing False Ministers
By
Series: Kingdom Contenders. Price: $0.99 USD. Words: 2,750. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Ministry / General
In this publication, we will explore the subject of false ministers. Jesus said that many would come in His name. As Christians, we need to be able to identify false ministers.
Walk in the Spirit: Biblical Studies in Christian Conduct
By
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,120. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
God has a standard of living that we, as believers, must live by. However, we must remember that our good works and acts must be a product of Christ’s character being formed in us. In this publication, we will examine the proper conduct for the Christian.
The Chastening of the Lord: Biblical Studies in God's Discipline
By
Series: Kingdom Citizens. Price: $0.99 USD. Words: 2,770. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will look closely at the place of God’s discipline in the Christian Life.
Let This Mind Be In You: Biblical Studies in Christian Character
By
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,510. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss Kingdom Character. We will examine the appropriate character of the Christian.
No Man Knows the Hour: Biblical Studies in the Coming Kingdom
By
Series: Kingdom Citizens. Price: $0.99 USD. Words: 3,410. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss the coming Kingdom of heaven.
Conformed to His Image: Biblical Studies in Predestination
By
Series: Kingdom Citizens. Price: $0.99 USD. Words: 2,230. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / General
In this publication, we will discuss the predestination of God. When we speak of predestination in this publication, we are referring to what God has intended or purposed for your life.
Enoch, the Righteous: A Brief Expository of the Man Who Pleased God
By
Series: Biblical Character Studies. Price: $2.99 USD. Words: 2,890. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Studies / Bible Study Guides
In this publication, we will explore the life of Enoch. Through his example, we will learn how to please the Lord in our walk with him.
Manasseh, the Repentant: A Brief Expository of the Forgetful King
By
Series: Biblical Character Studies. Price: $2.99 USD. Words: 4,940. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Theology / General
In this publication, we will explore the life of Manasseh, the son of Hezekiah. It is our hope that this story will challenge believers to forsake anything that displeases the Lord.
Motives in Ministry: Defining the Proper Motives for Ministry and Service
By
Series: Christian Leadership. Price: $2.99 USD. Words: 5,450. Language: English. Published: November 7, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Ministry / General
In this brief study, we will examine the proper motives for Christian ministry and service; and also motives to avoid.
Study to Show Yourself Approved: Exploring Christian Concepts for Victorious Living
By
Series: Christian Inspirational Lessons. Price: $0.99 USD. Words: 7,720. Language: English. Published: October 17, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / Inspirational
In this book, we have compiled select teachings and exhortations to help the Christian become the proverbial master of his domain.
The Walk of Faith: Exploring Christian Precepts for Victorious Living
By
Series: Christian Inspirational Lessons. Price: $0.99 USD. Words: 7,900. Language: English. Published: October 17, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Life / Inspirational
In this book, we have compiled select teachings and exhortations to transform the Christian's walk with Christ.
Troubled on Every Side: How God Uses People and Problems to Prepare Us for Ministry and Service
By
Series: Christian Leadership. Price: $2.99 USD. Words: 3,960. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Ministry / General
In the pages of this book, we will discuss how God uses problematic people and situations to prepare us before and during ministry for effective service.
The Prophetic Ministry: Exploring the Prophetic Office and Gift
By
Series: Spiritual Gifts. Price: $0.99 USD. Words: 10,520. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Ministry / General
This publication presents a solid introduction to the prophetic ministry. It will bring clarity and understanding to the prophetic office, the prophetic anointing, and the gift of prophecy.
The Apostolic Ministry: Exploring the Apostolic Office and Gift
By
Series: Spiritual Gifts. Price: $0.99 USD. Words: 9,440. Language: English. Published: April 20, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Ministry / General
This publication presents a solid introduction to the apostolic ministry. It will bring clarity and understanding to the apostolic office, the apostolic anointing, and apostleship.
The Mystery of Sonship: Exploring the Relationship between Salvation, Servant-hood, and Sonship
By
Series: Kingdom Mystery. Price: $2.99 USD. Words: 5,980. Language: English. Published: April 16, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Studies / Paul’s Letters
In this book, we will explore the mystery of sonship. Our salvation does not only entitle us to right-standing with God, but also relationship.
The Mystery of God: A Biblical Approach to Understanding the Godhead
By
Series: Kingdom Mystery. Price: $3.95 USD. Words: 16,510. Language: English. Published: April 15, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christian Theology / Apologetics
In the pages of this book, we will plainly discuss the Godhead; that is, the divine nature of God. Through the presentation of biblical truth, we will bring clarity to this controversial subject.
The Epistle of Titus: The Evans Practical Bible Commentary
By
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 4,870. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, we will examine one of the pastoral letters of Paul. In his epistle to Titus, the Christian learns of the controversies and challenges facing the early church. The Christian is reminded to be demonstrators of the gospel message in private and public affairs. In doing so, the gospel of Christ is adorned.
The Epistle of Philemon: The Evans Practical Bible Commentary
By
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 3,950. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, learn valuable lessons for the Christian faith. Paul's epistle to Philemon reminds Christians of the respect that should be present in the Church.
The Epistle of Jude: The Evans Practical Bible Commentary
By
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 5,290. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Commentary / New Testament
In this commentary, discover practical truths for the Christian life. Jude wrote to warn the believers against false brethren and to challenge them to contend for the faith of Jesus Christ.
Leviticus 1 (The Burnt Offering): The Evans Practical Bible Commentary
By
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 4,540. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Commentary / Old Testament
In this commentary, we will examine one of the most important offerings of the Old Testament, the whole burnt offering.
The Book of Obadiah: The Evans Practical Bible Commentary
By
Series: Bible Reference and Commentaries. Price: $1.95 USD. Words: 3,180. Language: English. Published: January 14, 2012 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Biblical Commentary / Old Testament
In this commentary, we will examine the shortest book of the Old Testament; the prophecy of Obadiah. It serves as a warning to the nations of God's righteous judgment coming upon the earth. The Christian is reminded of God's faithfulness which will extend to His rule for all eternity.
The Way of Prayer: How to Pray for God's Protection and Deliverance
By
Series: Prayer. Price: $2.99 USD. Words: 8,040. Language: English. Published: March 19, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
Prayer is an essential component to the believer’s walk with the Lord. Through prayer Christians communicate with God and receive strength. Therefore, a consistent prayer life is important. In this book, we will examine Jehoshaphat's prayer for God's protection and deliverance and Asa’s prayer for God’s presence and strength.
The Apostolic Paradigm Shift: Examining the Coming Reformation of Apostles and Apostolic Ministry
By
Price: $3.95 USD. Words: 10,460. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
In this book, we will explain the apostolic paradigm shift God is sending in the Church.
When God Says No: Understanding the Fatherhood of God
By
Price: $3.95 USD. Words: 13,160. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
In the pages of this book, we want to explore reasons why the answer of God to us is not always right in our eyes. We will examine causes for the Lord denying the request of our hearts.
The Word Was Made Flesh: The Principles of Christ versus the Personality of Christ
By
Price: $2.99 USD. Words: 15,080. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
When we understand how the principles of Christ and the personality of Christ operate together, we will grow in our understanding of His Word and His ways.
The Once Saved Always Saved Controversy: Confronting the Doctrine of Eternal Security
By
Series: Kingdom Contenders. Price: $2.99 USD. Words: 4,150. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
What is the Doctrine of Eternal Security? Proponents of this doctrine assert that after one is converted; regardless of lifestyle choices, they will enter into heaven. Is this true? What does the Bible say about it? In this publication, we will provide answers to these questions.
The World, The Flesh, and The Devil: Practical Insights to Living Victoriously in Christ
By
Price: $2.99 USD. Words: 23,890. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
The World, The Flesh, and The Devil provides guidelines for overcoming the three battlegrounds every Christian faces: the world, the flesh, and the devil. Learn how you can walk in the power of God. Discover how you, too, can live victoriously in Christ.
The Apostle Question: Exploring the Role of Apostles in the New Testament Church
By
Price: $4.95 USD. Words: 20,480. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
The focus of this book is to bring clarity and understanding to the role of the apostle in the Church. Sound biblical answers to questions concerning the function of the apostle are answered.
Ananias Men's Fellowship Presents... What Is Man?: Defining the Christian Male
By
Series: Christian Men's Studies, Book 1. Price: $2.99 USD. Words: 9,590. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
What is Man? It is repeatedly asked in the scriptures. When God created man (more specifically, the male), He had a purpose in mind.In this book, we will examine this notable question.
The Mystery of the Thorn: A Study of Paul's Thorn in the Flesh
By
Series: Kingdom Mystery. Price: $3.95 USD. Words: 7,610. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
In this book, we will explore the mystery of the thorn in the flesh. Paul stated that God had given him a thorn in his flesh in order to keep him humble because of the revelation that was in his life. However, there has been much controversy over what the thorn in his flesh was, and how God could allow such a thing to exist.
If They Be Prophets: An Examination of the Prophetic Office and Gift
By
Price: $4.95 USD. Words: 16,700. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
This book brings clarity to the role of the prophet in the New Testament Church. In addition, it explores the prophetic person and the prophetic anointing. It is our prayer that believers will recognize the operation of the prophetic office and gift in the Church.
The Christian Teen's Guide to Relationships: Exploring Issues and Answers for Healthy Relationships
By
Price: $2.99 USD. Words: 5,910. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
In this book, we will discuss relationships and the Christian teen. The Christian teen will discover how to have positive and wholesome friendships and relationships.
The Spiritual Gifts: A Biblical Explanation of the Gifts of the Spirit
By
Price: $2.99 USD. Words: 9,530. Language: English. Published: January 13, 2011 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
In this book, we will take a biblical approach to examining and explaining the gifts and ministries of the Spirit, their functions, and how to recognize them in operation.
The Call to Serve: An Examination of the Deacon and Servant's Ministry in the Church
By
Series: Christian Men's Studies, Book 2. Price: $2.99 USD. Words: 7,440. Language: English. Published: November 7, 2010 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
In this book, we will examine the history and subsequent development of the Deacon's office in the Church. In addition, we will learn how the first men who were appointed to serve in the Church are the standard for which deacons and servants are to evaluate their service today. In doing so, the Church, deacons, and those called to serve will benefit from mutual understanding and cooperation.
Samson, the Nazarite: A Brief Expository of God's Strong Man
By
Series: Biblical Character Studies. Price: $2.99 USD. Words: 6,680. Language: English. Published: November 7, 2010 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
In this book, we will explore the life of Samson, the Nazarite. Believers can learn from his mistakes and emulate his successes.
Precepts for Kingdom Living: Protocols and Perspectives in the Kingdom of God
By
Price: $0.99 USD. Words: 12,650. Language: English. Published: November 7, 2010 by Abundant Truth Publishing. Category: Nonfiction » Religion and Spirituality » Christianity
The kingdom of God is revealed through the acceptance of Jesus Christ. He told Nicodemus that unless one is born again, he cannot see the kingdom of God. However, those who have received Christ are members of the kingdom of God. There are standards and protocols that exist in the kingdom of God. In this book, we will explore seven foundational truths concerning the kingdom of God. Book 1 of 2.
View more...

Roderick L. Evans’s tag cloud

abundant    abundant truth    adam    always saved    anointing    answers    anti    apologetic    aposolic    apostle    apostles    apostlesprophetsprophetapostleapostolicfoundationchurchleadersministryprophetic    apostolic    apostolic ministry    assembly    believe    believer    bible    bible study    builders    burnt offering    call    calvinism    chance    character    characters    charisma    charismatic    chasten    christ    christian    christology    church    coming    commentary    concept    conduct    corithians    correction    covenant    creation    dating    day    deacon    delilah    deliverance    destiny    devil    disciple    discipleship    discipline    doctrine    elijah    endtimes    enoch    eternal    evans    expository    failure    faith    false    false teachers    father    fatherhood    fevefold    fivefold    flesh    forgiveness    galatians    gift    gifts    god    god says no    godhead    groups    growth    healthy    holiness    holy    hope    image    inspirational    jehoshaphat    jehovah    jesus    jude    keys    king    kingdom    last    law    lazarus    leadership    led    lessons    leviticus    life    living    love    man    manasseh    mantle    married    melchizedek    men studies    mind    minister    ministering    ministers    ministry    motives    nazarite    new    no    noah    obadiah    office    once    our father    overcome    pain    pastor    pastoral    paul    pentecostal    personality    perspectives    peter    philemon    pray    prayer    precept    precepts    predestination    prepare    priesthood    principle    prophecy    prophesy    prophet    prophetic    prophetic ministry    prophets    protection    protocols    rainbow    redeem    reformation    relationships    repent    restoration    restore    reward    righteous    roderick    roderickevanschristianlifeserviceministrysuccessfulabundanttruth    royal    samson    sanctification    saved    says    security    servant    serve    service    signs    sonship    spirit    strength    strong    studies    study    suffering    teach    teacher    teachers    teaching    teen    testament    theology    theory    thorn    titus    tongues    transformed    tree of life    trinity    truth    truths    victory    walk    warfare    when    wholesome    will of god    witness    word made flesh    world    youth ministry